PHLDA1 Antibody - middle region : HRP

PHLDA1 Antibody - middle region : HRP
Artikelnummer
AVIARP54809_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHLDA1

Key Reference: Nagai,M.A., (2007) Breast Cancer Res. Treat. 106 (1), 49-56

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pleckstrin homology-like domain family A member 1

Protein Size: 401

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54809_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54809_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22822
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×