PI4K2B Antibody - middle region : FITC

PI4K2B Antibody - middle region : FITC
Artikelnummer
AVIARP57204_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phosphatidylinositol 4-kinases (PI4Ks) phosphorylate phosphatidylinositol to generate phosphatidylinositol 4-phosphate (PIP), an immediate precursor of several important signaling and scaffolding molecules. PIP itself may also have direct functional and s

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PI4K2B

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylinositol 4-kinase type 2-beta

Protein Size: 481

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57204_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57204_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55300
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×