Pi4k2b Antibody - N-terminal region : HRP

Pi4k2b Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57203_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) Pi4k2b contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Pi4k2b contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: EDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphatidylinositol 4-kinase type 2-beta

Protein Size: 469

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57203_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57203_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 67073
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×