English
PITPNB Antibody - middle region : HRP
PITPNB Antibody - middle region : HRP
Artikelnummer
AVIARP54893_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. The protein encoded by this gene is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PITPNB
Key Reference: Morgan,C.P., (2006) Biochem. J. 398 (3), 411-421
Molecular Weight: 31kDa
Peptide Sequence: Synthetic peptide located within the following region: FFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKA
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Phosphatidylinositol transfer protein beta isoform
Protein Size: 271
Purification: Affinity Purified
Description of Target: PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. The protein encoded by this gene is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PITPNB
Key Reference: Morgan,C.P., (2006) Biochem. J. 398 (3), 411-421
Molecular Weight: 31kDa
Peptide Sequence: Synthetic peptide located within the following region: FFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKA
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Phosphatidylinositol transfer protein beta isoform
Protein Size: 271
Purification: Affinity Purified
| Artikelnummer | AVIARP54893_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54893_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 23760 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
