PLCB1 Antibody - middle region : Biotin

PLCB1 Antibody - middle region : Biotin
Artikelnummer
AVIARP55844_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLCB1

Key Reference: Fantuzzi,L., (2008) Blood 111 (7), 3355-3363

Molecular Weight: 134kDa

Peptide Sequence: Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1

Protein Size: 1173

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55844_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55844_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23236
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×