PLCD1 Antibody - N-terminal region : HRP

PLCD1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56689_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLCD1

Key Reference: Fu,L., (2007) Cancer Res. 67 (22), 10720-10726

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1

Protein Size: 756

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56689_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56689_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5333
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×