English
PLCD1 Antibody - N-terminal region : HRP
PLCD1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56690_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLCD1
Key Reference: Fu,L., (2007) Cancer Res. 67 (22), 10720-10726
Molecular Weight: 86kDa
Peptide Sequence: Synthetic peptide located within the following region: HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
Protein Size: 756
Purification: Affinity Purified
Description of Target: Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLCD1
Key Reference: Fu,L., (2007) Cancer Res. 67 (22), 10720-10726
Molecular Weight: 86kDa
Peptide Sequence: Synthetic peptide located within the following region: HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
Protein Size: 756
Purification: Affinity Purified
| Artikelnummer | AVIARP56690_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56690_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 5333 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
