PLS3 Antibody - middle region : Biotin

PLS3 Antibody - middle region : Biotin
Artikelnummer
AVIARP56623_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLS3

Key Reference: Oprea,G.E., (2008) Science 320 (5875), 524-527

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plastin-3

Protein Size: 630

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56623_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56623_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5358
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×