English
PLSCR1 Antibody - N-terminal region : HRP
PLSCR1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57514_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLSCR1
Molecular Weight: 35kDa
Peptide Sequence: Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Phospholipid scramblase 1
Protein Size: 318
Purification: Affinity Purified
Description of Target: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLSCR1
Molecular Weight: 35kDa
Peptide Sequence: Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Phospholipid scramblase 1
Protein Size: 318
Purification: Affinity Purified
| Artikelnummer | AVIARP57514_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57514_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rabbit, Dog (Canine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting, Immunohistochemistry |
| Human Gene ID | 5359 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
