PLSCR3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR3 may play a central role in the initiation of fibr

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLSCR3

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phospholipid scramblase 3

Protein Size: 295

Purification: Affinity Purified

• Artikelnummer: AVIARP57395_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57395_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57048
• Wirt: Rabbit