PMS2 Antibody - middle region : Biotin

PMS2 Antibody - middle region : Biotin
Artikelnummer
AVIARP56117_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PMS2 is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors.This gene is one of the PMS2 gene family members found in clusters on chromosome 7. The product of this gene is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors. Alternatively spliced transcript variants have been observed for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PMS2

Key Reference: Jackson,C.C., (2008) Pediatr Blood Cancer 50 (6), 1268-1270

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: INKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mismatch repair endonuclease PMS2

Protein Size: 862

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56117_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56117_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5395
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×