PNOC Antibody - middle region : Biotin

PNOC Antibody - middle region : Biotin
Artikelnummer
AVIARP56692_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNOC

Key Reference: Williams,J.P., (2008) Anesth. Analg. 106 (3), 865-866

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prepronociceptin

Protein Size: 176

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56692_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56692_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5368
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×