English
PNPLA2 Antibody - middle region : Biotin
PNPLA2 Antibody - middle region : Biotin
Artikelnummer
AVIARP58938_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: This gene encodes an enzyme which catalyzes the first step in the hydrolysis of triglycerides in adipose tissue. Mutations in this gene are associated with neutral lipid storage disease with myopathy.
Molecular Weight: 55kDa
Peptide Sequence: Synthetic peptide located within the following region: RDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPG
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Patatin-like phospholipase domain-containing protein 2
Protein Size: 504
Purification: Affinity Purified
Description of Target: This gene encodes an enzyme which catalyzes the first step in the hydrolysis of triglycerides in adipose tissue. Mutations in this gene are associated with neutral lipid storage disease with myopathy.
Molecular Weight: 55kDa
Peptide Sequence: Synthetic peptide located within the following region: RDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPG
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Patatin-like phospholipase domain-containing protein 2
Protein Size: 504
Purification: Affinity Purified
| Artikelnummer | AVIARP58938_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58938_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting, Immunohistochemistry |
| Human Gene ID | 57104 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
