PNPO Antibody - N-terminal region : Biotin

PNPO Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58515_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PNPO catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine.Vitamin B6, or pyridoxal 5-prime-phosphate (PLP), is critical for normal cellular function, and some cancer cells have notable differences in vitamin B6 metabolism compared to their normal counterparts. The rate-limiting enzyme in vitamin B6 synthesis is pyridoxine-5-prime-phosphate (PNP) oxidase (PNPO; EC 1.4.3.5).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PNPO

Key Reference: Song,H., Schizophr. Res. 97 (1-3), 264-270 (2007)

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyridoxine-5'-phosphate oxidase

Protein Size: 261

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58515_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58515_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55163
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×