POLE3 Antibody - N-terminal region : FITC

POLE3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58048_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POLE3

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: AERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA polymerase epsilon subunit 3

Protein Size: 147

Purification: Affinity Purified

Subunit: 3
Mehr Informationen
Artikelnummer AVIARP58048_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58048_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54107
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×