POLL Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: POLL is a repair polymerase.It is involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLL

Key Reference: Picher,A.J. (2007) DNA Repair (Amst.) 6 (12), 1749-1756

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA polymerase lambda

Protein Size: 575

Purification: Affinity Purified

• Artikelnummer: AVIARP54924_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54924_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 27343
• Wirt: Rabbit