POLR1E Antibody - N-terminal region : FITC

POLR1E Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57639_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: POLR1E is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.POLR1E is the component of RNA polymerase I which synthesizes ribosomal RNA precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POLR1E

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA-directed RNA polymerase I subunit RPA49

Protein Size: 419

Purification: Affinity Purified

Subunit: RPA49
Mehr Informationen
Artikelnummer AVIARP57639_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57639_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64425
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×