POP5 Antibody - middle region : HRP

POP5 Antibody - middle region : HRP
Artikelnummer
AVIARP56773_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: POP5 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.POP5 is also a component of RNase MRP.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POP5

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ribonuclease P/MRP protein subunit POP5

Protein Size: 163

Purification: Affinity Purified

Subunit: POP5
Mehr Informationen
Artikelnummer AVIARP56773_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56773_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51367
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×