PPIL2 Antibody - C-terminal region : FITC

PPIL2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP55026_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. This protein interacts with the proteinase inhibitor eglin c and is localized in the nucleus. This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. This protein interacts with the proteinase inhibitor eglin c and is localized in the nucleus. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PPIL2

Key Reference: Pushkarsky,T., (2005) J. Biol. Chem. 280 (30), 27866-27871

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase-like 2

Protein Size: 520

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55026_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55026_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 23759
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×