PPIL2 Antibody - middle region : Biotin

PPIL2 Antibody - middle region : Biotin
Artikelnummer
AVIARP55025_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 vir

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPIL2

Key Reference: Pushkarsky,T., (2005) J. Biol. Chem. 280 (30), 27866-27871

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase-like 2

Protein Size: 520

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55025_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55025_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23759
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×