PPIL2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 vir

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPIL2

Key Reference: Pushkarsky,T., (2005) J. Biol. Chem. 280 (30), 27866-27871

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase-like 2

Protein Size: 520

Purification: Affinity Purified

• Artikelnummer: AVIARP55025_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55025_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23759
• Wirt: Rabbit