PPOX Antibody - C-terminal region : FITC

PPOX Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56096_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes the penultimate enzyme of heme biosynthesis, which catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX. Mutations in this gene cause variegate porphyria, an autosomal dominant disorder of heme metabolism resulting from a deficiency in protoporphyrinogen oxidase, an enzyme located on the inner mitochondrial membrane. Alternatively spliced transcript variants encoding the same protein have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PPOX

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: GGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGKEPDETVHSFAQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protoporphyrinogen oxidase

Protein Size: 158

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56096_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56096_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5498
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×