Ppp1r7 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ppp1r7 is a regulatory subunit of protein phosphatase 1.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: SHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase 1 regulatory subunit 7

Protein Size: 360

Purification: Affinity Purified

Subunit: 7

• Artikelnummer: AVIARP56408_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56408_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 301618
• Wirt: Rabbit