PPP4R3A Antibody - middle region : HRP

PPP4R3A Antibody - middle region : HRP
Artikelnummer
AVIARP57688_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMEK1

Molecular Weight: 94kDa

Peptide Sequence: Synthetic peptide located within the following region: YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDAR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: serine/threonine-protein phosphatase 4 regulatory subunit 3A

Protein Size: 820

Purification: Affinity Purified

Subunit: 3A
Mehr Informationen
Artikelnummer AVIARP57688_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57688_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55671
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×