Ppp4r4 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ppp4r4 is a putative regulatory subunit of serine/threonine-protein phosphatase 4.

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: VKKTVLELDRMEMSMDMFQKKNYEKDLLDQEKEREELLFLEMEQLEKEKH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 4 regulatory subunit 4

Protein Size: 875

Purification: Affinity Purified

Subunit: 4

• Artikelnummer: AVIARP57709_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57709_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 74521
• Wirt: Rabbit