PPP6R1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Protein phosphatase regulatory subunits, such as SAPS1, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS1 is a regulatory subunit for the protein phosphatase-6 catalytic subunit (PPP6C; MIM 300141) (Stefansson and Brautigan, 2006 [PubMed 16769727]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP6R1

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 6 regulatory subunit 1

Protein Size: 881

Purification: Affinity Purified

• Artikelnummer: AVIARP55109_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55109_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22870
• Wirt: Rabbit