PRAME Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PRAME functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. PRAME prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.This gene encodes an antigen that is predominantly expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. This expression pattern is similar to that of other CT antigens, such as MAGE, BAGE and GAGE. However, unlike these other CT antigens, this gene is also expressed in acute leukemias. Five alternatively spliced transcript variants encoding the same protein have been observed for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRAME

Key Reference: Rogozin,I.B., (2007) Leuk. Res. 31 (11), 1521-1528

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Melanoma antigen preferentially expressed in tumors

Protein Size: 509

Purification: Affinity Purified

• Artikelnummer: AVIARP55981_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55981_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23532
• Wirt: Rabbit