PREP Antibody - middle region : FITC

PREP Antibody - middle region : FITC
Artikelnummer
AVIARP56414_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PREP is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and d

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PREP

Key Reference: Myohanen,T.T., (2007) Neurochem. Res. 32 (8), 1365-1374

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prolyl endopeptidase

Protein Size: 710

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56414_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56414_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5550
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×