PrEST Antigen CYP11B2

cytochrome P450 family 11 subfamily B member 2

Sequence: WVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLS

GeneName: CYP11B2

Ensembl Gene ID: ENSG00000179142

UniProt ID: P19099

Entrez Gene ID: 1585

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000022589: 74%, ENSRNOG00000030111: 71%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96158-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96158-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 1585
• Konjugat: Unconjugated