PrEST Antigen FAM228A

family with sequence similarity 228 member A

GeneName: FAM228A

Sequence: FTFTSHCVIPKEWHKASARARSKTYKYSPEKLIYADKKQKRKEKKTADLSQAAFERQFLSSKLSQKNKVGERKGLVSRGLGRGWHAGLCSTHE

Interspecies Mouse/Rat: ENSRNOG00000050114: 36%, ENSMUSG00000079177: 35%

Entrez Gene ID: 653140

UniProt ID: Q86W67

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000186453

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96157-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96157-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 653140