PrEST Antigen GPC6

glypican 6

GeneName: GPC6

Sequence: AYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDSSAAQRGHSLLSWSLTCIVLAL

Interspecies Mouse/Rat: ENSMUSG00000058571: 86%, ENSRNOG00000046660: 86%

Entrez Gene ID: 10082

UniProt ID: Q9Y625

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000183098

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96131-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96131-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 10082