PrEST Antigen HDAC10

histone deacetylase 10

GeneName: HDAC10

Sequence: LTTPDITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIAATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALSMFHVS

Interspecies Mouse/Rat: ENSMUSG00000062906: 64%, ENSRNOG00000031915: 51%

Entrez Gene ID: 83933

UniProt ID: Q969S8

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000100429

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96139-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96139-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 83933