PrEST Antigen INS-IGF2

INS-IGF2 readthrough

GeneName: INS-IGF2

Sequence: PVLFIHCPGAAGTAQGLEYRGRRVTTEPVWEEVDSSPQPQGSESLPAQPP

Interspecies Mouse/Rat: ENSRNOG00000021048: 36%, ENSMUSG00000115302: 46%

Entrez Gene ID: 723961

UniProt ID: F8WCM5

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000129965

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96107-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96107-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 723961