PrEST Antigen TBC1D22A

TBC1 domain family member 22A

GeneName: TBC1D22A

Sequence: PLLHGTLLRSTAKMPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQR

Interspecies Mouse/Rat: ENSMUSG00000051864: 93%, ENSRNOG00000017057: 93%

Entrez Gene ID: 25771

UniProt ID: Q8WUA7

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000054611

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96194-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96194-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 25771