PrEST Antigen USP43

ubiquitin specific peptidase 43

GeneName: USP43

Sequence: EEDLNTIAEGDNVYAFQVPPSPSQGTLSAHPLGLSASPRLAAREGQRFSLSLHSESKVLILFCNLVGSGQQASRFGPPFLIREDRAVSWAQLQQSILSKVRHLMKSEAPVQNLGSLFSIRVVGLSVACSYLSPKD

Interspecies Mouse/Rat: ENSMUSG00000020905: 81%, ENSRNOG00000003785: 76%

Entrez Gene ID: 124739

UniProt ID: Q70EL4

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000154914

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96126-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96126-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 124739