PRKAB1 Antibody - N-terminal region : Biotin

PRKAB1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56699_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKAB1

Key Reference: Hasumi,H., Gene 415 (1-2), 60-67 (2008)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'-AMP-activated protein kinase subunit beta-1

Protein Size: 270

Purification: Affinity Purified

Subunit: beta-1
Mehr Informationen
Artikelnummer AVIARP56699_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56699_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5564
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×