English
PRKAB1 Antibody - N-terminal region : HRP
PRKAB1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56699_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKAB1
Key Reference: Hasumi,H., Gene 415 (1-2), 60-67 (2008)
Molecular Weight: 30kDa
Peptide Sequence: Synthetic peptide located within the following region: KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: 5'-AMP-activated protein kinase subunit beta-1
Protein Size: 270
Purification: Affinity Purified
Subunit: beta-1
Description of Target: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKAB1
Key Reference: Hasumi,H., Gene 415 (1-2), 60-67 (2008)
Molecular Weight: 30kDa
Peptide Sequence: Synthetic peptide located within the following region: KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: 5'-AMP-activated protein kinase subunit beta-1
Protein Size: 270
Purification: Affinity Purified
Subunit: beta-1
| Artikelnummer | AVIARP56699_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56699_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 5564 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
