English
Prkab2 Antibody - N-terminal region : Biotin
Prkab2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56638_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: Prkab2 is a component of the AMPK alpha2beta2gamma1 complex which phosphorylates glycogen synthase.
Molecular Weight: 29kDa
Peptide Sequence: Synthetic peptide located within the following region: HKIMVGSTDDPSVFSLPDSKLPGDKEFVPWQQDLDDSVKPTQQARPTVIR
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: 5'-AMP-activated protein kinase subunit beta-2
Protein Size: 271
Purification: Affinity Purified
Subunit: beta-2
Description of Target: Prkab2 is a component of the AMPK alpha2beta2gamma1 complex which phosphorylates glycogen synthase.
Molecular Weight: 29kDa
Peptide Sequence: Synthetic peptide located within the following region: HKIMVGSTDDPSVFSLPDSKLPGDKEFVPWQQDLDDSVKPTQQARPTVIR
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: 5'-AMP-activated protein kinase subunit beta-2
Protein Size: 271
Purification: Affinity Purified
Subunit: beta-2
| Artikelnummer | AVIARP56638_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56638_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 64562 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
