Prkab2 Antibody - N-terminal region : FITC

Prkab2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56638_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Prkab2 is a component of the AMPK alpha2beta2gamma1 complex which phosphorylates glycogen synthase.

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: HKIMVGSTDDPSVFSLPDSKLPGDKEFVPWQQDLDDSVKPTQQARPTVIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'-AMP-activated protein kinase subunit beta-2

Protein Size: 271

Purification: Affinity Purified

Subunit: beta-2
Mehr Informationen
Artikelnummer AVIARP56638_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56638_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64562
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×