PRKCB1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCB1

Key Reference: Tatematsu,K., (2008) J. Biol. Chem. 283 (17), 11575-11585

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein kinase C beta type

Protein Size: 673

Purification: Affinity Purified

• Artikelnummer: AVIARP56423_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56423_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5579
• Wirt: Rabbit