PRKCD Antibody - N-terminal region : HRP

PRKCD Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56701_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of mouse PRKCD

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: NSYELGSLQVEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKTTF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: protein kinase C delta type

Protein Size: 487

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56701_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56701_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5580
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×