PRKY Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromsoome. The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKY

Key Reference: Skaletsky,H., (2003) Nature 423 (6942), 825-837

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 277

Purification: Affinity Purified

• Artikelnummer: AVIARP56441_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56441_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5616
• Wirt: Rabbit