Pros1 Antibody - C-terminal region : HRP

Pros1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56098_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pros1 is a component of the Protein C/Protein S anticoagulant system; human homolog interacts with factor Xa, factor Va, and phospholipids to inhibit prothrombin activation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Vitamin K-dependent protein S

Protein Size: 675

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56098_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56098_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 81750
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×