PRSS22 Antibody - N-terminal region : Biotin

PRSS22 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57603_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS22

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Brain-specific serine protease 4

Protein Size: 317

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57603_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57603_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64063
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×