English
PRSS3 Antibody - N-terminal region : Biotin
PRSS3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56447_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene is localized to the locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS3
Molecular Weight: 33kDa
Peptide Sequence: Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Trypsin-3
Protein Size: 304
Purification: Affinity Purified
Description of Target: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene is localized to the locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS3
Molecular Weight: 33kDa
Peptide Sequence: Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Trypsin-3
Protein Size: 304
Purification: Affinity Purified
| Artikelnummer | AVIARP56447_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56447_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 5646 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
