PRSS8 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRSS8

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prostasin

Protein Size: 343

Purification: Affinity Purified

• Artikelnummer: AVIARP56449_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56449_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5652
• Wirt: Rabbit