English
PRUNE1 Antibody - C-terminal region : FITC
PRUNE1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57538_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: This gene encodes a member of the DHH protein superfamily of phosphoesterases. This protein has been found to function as both a nucleotide phosphodiesterase and an exopolyphosphatase. This protein is believed to stimulate cancer progression and metastases through the induction of cell motility. A pseuodgene has been identified on chromosome 13. Alternative splicing results in multiple transcript variants.
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PRUNE
Molecular Weight: 26kDa
Peptide Sequence: Synthetic peptide located within the following region: NSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQIS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: exopolyphosphatase PRUNE1
Protein Size: 241
Purification: Affinity Purified
Description of Target: This gene encodes a member of the DHH protein superfamily of phosphoesterases. This protein has been found to function as both a nucleotide phosphodiesterase and an exopolyphosphatase. This protein is believed to stimulate cancer progression and metastases through the induction of cell motility. A pseuodgene has been identified on chromosome 13. Alternative splicing results in multiple transcript variants.
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PRUNE
Molecular Weight: 26kDa
Peptide Sequence: Synthetic peptide located within the following region: NSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQIS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: exopolyphosphatase PRUNE1
Protein Size: 241
Purification: Affinity Purified
| Artikelnummer | AVIARP57538_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57538_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 58497 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
