PSMA3 Antibody - middle region : Biotin

PSMA3 Antibody - middle region : Biotin
Artikelnummer
AVIARP57742_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PSMA3

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proteasome subunit alpha type-3

Protein Size: 248

Purification: Affinity Purified

Subunit: alpha type-3
Mehr Informationen
Artikelnummer AVIARP57742_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57742_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5684
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×