English
PSMA4 Antibody - N-terminal region : Biotin
PSMA4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56312_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMA4
Key Reference: Amos,C.I., (2008) Nat. Genet. 40 (5), 616-622
Molecular Weight: 21kDa
Peptide Sequence: Synthetic peptide located within the following region: PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Proteasome subunit alpha type-4
Protein Size: 190
Purification: Affinity Purified
Subunit: alpha type-4
Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMA4
Key Reference: Amos,C.I., (2008) Nat. Genet. 40 (5), 616-622
Molecular Weight: 21kDa
Peptide Sequence: Synthetic peptide located within the following region: PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Proteasome subunit alpha type-4
Protein Size: 190
Purification: Affinity Purified
Subunit: alpha type-4
| Artikelnummer | AVIARP56312_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56312_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 5685 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
