PSMB6 Antibody - N-terminal region : HRP

PSMB6 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56469_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMB6

Key Reference: Listovsky,T., (2004) EMBO J. 23 (7), 1619-1626

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proteasome subunit beta type-6

Protein Size: 239

Purification: Affinity Purified

Subunit: beta type-6
Mehr Informationen
Artikelnummer AVIARP56469_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56469_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5694
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×